Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pandinus imperator Phospholipase A2 imperatoxin-1, partial

This Recombinant Pandinus imperator Phospholipase A2 imperatoxin-1, partial spans the amino acid sequence from region 32-135aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Imperatoxin I; IpTx1; IpTxi; Imperatoxin inhibitor; Imperatoxin I large subunit; Imperatoxin I small subunit

UniProt

P59888

Expression Region

32-135aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Pandinus imperator (Emperor scorpion)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNA Polymerase III Subunit B (POLR3B) Antibody
abx133711-01 30 µL

RNA Polymerase III Subunit B (POLR3B) Antibody

Sign In for Pricing
View Details
RNA Polymerase III Subunit B (POLR3B) Antibody
abx133711-02 100 µL

RNA Polymerase III Subunit B (POLR3B) Antibody

Sign In for Pricing
View Details
RNA Polymerase III Subunit B (POLR3B) Antibody
abx133711-03 200 µL

RNA Polymerase III Subunit B (POLR3B) Antibody

Sign In for Pricing
View Details
CLIC3 (Chloride Intracellular Channel Protein 3) (FITC)
125079-FITC 100 µL

CLIC3 (Chloride Intracellular Channel Protein 3) (FITC)

Sign In for Pricing
View Details
CCDC8, CT (CCDC8, Coiled-coil domain-containing protein 8) (PE) discontinued
033345-PE 200 µL

CCDC8, CT (CCDC8, Coiled-coil domain-containing protein 8) (PE) discontinued

Sign In for Pricing
View Details
Kdm4d-set siRNA/shRNA/RNAi Lentivector (Mouse)
25477094 4x 500 ng

Kdm4d-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details