Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calponin-2 (CNN2), partial

This Recombinant Human Calponin-2 (CNN2), partial spans the amino acid sequence from region 2-133aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calponin H2, smooth muscle; Neutral calponin

UniProt

Q99439

Expression Region

2-133aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIAGLTGLSIGPAFQAGLAAGTILCTLMNKLQPGSVPKINASMQNWAQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWP2 Antibody
KC-13109-01 50 μL

WWP2 Antibody

Sign In for Pricing
View Details
WWP2 Antibody
KC-13109-02 100 µL

WWP2 Antibody

Sign In for Pricing
View Details
WWP2 Antibody
KC-13109-03 1 mL

WWP2 Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB509767 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
Human Inhibin A (INHA) ELISA Kit
RDR-INHA-Hu-01 96 Tests

Human Inhibin A (INHA) ELISA Kit

Sign In for Pricing
View Details
Human Inhibin A (INHA) ELISA Kit
RDR-INHA-Hu-02 48 Tests

Human Inhibin A (INHA) ELISA Kit

Sign In for Pricing
View Details