Recombinant Human Calponin-2 (CNN2), partial
This Recombinant Human Calponin-2 (CNN2), partial spans the amino acid sequence from region 2-133aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Calponin H2, smooth muscle; Neutral calponin
UniProt
Q99439
Expression Region
2-133aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Musculoskeletal & Connective Tissue Research
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
19.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIAGLTGLSIGPAFQAGLAAGTILCTLMNKLQPGSVPKINASMQNWAQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal Glutamate Receptor 6 Antibody (818235) [Janelia Fluor 646]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
FAB9610J 0.1 mL
Mouse Monoclonal Glutamate Receptor 6 Antibody (818235) [Janelia Fluor 646]
Sign In for Pricing
View Details 
P9103-19C7-PE 200 µL
PKC delta, NT (Protein Kinase C, delta Type, nPKC-delta, PRKCD) (PE) discontinued
Sign In for Pricing
View Details 