Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 96 (LY96)

This Recombinant Human Lymphocyte antigen 96 (LY96) spans the amino acid sequence from region 19-160aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-96; ESOP-1; Protein MD-2

UniProt

Q9Y6Y9

Expression Region

19-160aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAF1 Human Gene Knockout Kit (CRISPR)
KN400103 1 Kit

PAF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS801600 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
Human FANCI activation kit by CRISPRa
GA110613 1 Kit

Human FANCI activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS647834 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
SARS-CoV-2 Spike Trimer Protein, His Tag (BA.2.38/Omicron) (MALS verified)
SPN-C522g-50ug 50 µg

SARS-CoV-2 Spike Trimer Protein, His Tag (BA.2.38/Omicron) (MALS verified)

Sign In for Pricing
View Details
Propiolic Acid
TRC-P827860-50G 50 g

Propiolic Acid

Sign In for Pricing
View Details