Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 96 (LY96)

This Recombinant Human Lymphocyte antigen 96 (LY96) spans the amino acid sequence from region 19-160aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-96; ESOP-1; Protein MD-2

UniProt

Q9Y6Y9

Expression Region

19-160aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Acetylacetanilide
TRC-A133000-50MG 50 mg

3-Acetylacetanilide

Sign In for Pricing
View Details
(2S)-N’-Nitrosonornicotine
TRC-N535001-10MG 10 mg

(2S)-N’-Nitrosonornicotine

Sign In for Pricing
View Details
LOC340065 Human qPCR Primer Pair (XM_295146)
HP221620 200 Reactions

LOC340065 Human qPCR Primer Pair (XM_295146)

Sign In for Pricing
View Details
Synaptopodin Recombinant Chimeric Antibody Antibody
HA610242 100 µg

Synaptopodin Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
3-Bromo-5-(pentafluorosulfur)benzoic Acid
TRC-B010622-250MG 250 mg

3-Bromo-5-(pentafluorosulfur)benzoic Acid

Sign In for Pricing
View Details
TRIM72 Antibody
KC-2395-01 50 μL

TRIM72 Antibody

Sign In for Pricing
View Details