Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bungarus multicinctus Alpha-bungarotoxin isoform V31

This Recombinant Bungarus multicinctus Alpha-bungarotoxin isoform V31 spans the amino acid sequence from region 22-95aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-BTX V31; Alpha-BgtV31; BGTX V31; Long neurotoxin 1

UniProt

P60616

Expression Region

22-95aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bungarus multicinctus (Many-banded krait)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal VEGFR2/KDR/Flk-1 Antibody (89106R) [Janelia Fluor 585]
FAB3572RJF585 0.1 mL

Mouse Monoclonal VEGFR2/KDR/Flk-1 Antibody (89106R) [Janelia Fluor 585]

Sign In for Pricing
View Details
Human Blood NK Cells, Positive
ABC-TC3114 1 Vial

Human Blood NK Cells, Positive

Sign In for Pricing
View Details
Rabbit Polyclonal SH3BP5 Antibody
NBP2-20344 0.1 mL

Rabbit Polyclonal SH3BP5 Antibody

Sign In for Pricing
View Details
4-[Cyclohexyl (methyl) amino]benzene-1-carboximidamide
UQB47855-01 250 mg

4-[Cyclohexyl (methyl) amino]benzene-1-carboximidamide

Sign In for Pricing
View Details
4-[Cyclohexyl (methyl) amino]benzene-1-carboximidamide
UQB47855-02 2.5 g

4-[Cyclohexyl (methyl) amino]benzene-1-carboximidamide

Sign In for Pricing
View Details
Automatic Digital Refractometer    RX-5000i-Plus
1213471 1 Unit

Automatic Digital Refractometer RX-5000i-Plus

Sign In for Pricing
View Details