Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arylacetamide deacetylase (AADAC)

This Recombinant Human Arylacetamide deacetylase (AADAC) spans the amino acid sequence from region 1-399aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DAC

UniProt

P22760

Expression Region

1-399aa

Tag

C-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NFKB Activating Protein (NKAP) ELISA Kit
RDR-NKAP-Mu-96Tests 96 Tests

Mouse NFKB Activating Protein (NKAP) ELISA Kit

Sign In for Pricing
View Details
GNG11 (NM_004126) Human 3' UTR Clone
SC204030 10 µg

GNG11 (NM_004126) Human 3' UTR Clone

Sign In for Pricing
View Details
SEC61G Protein Vector (Human) (pPM-C-His)
PV037236 500 ng

SEC61G Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GALK1 Antibody
E309556 200 µL

GALK1 Antibody

Sign In for Pricing
View Details
Hectd2 (NM_172637) Mouse Tagged ORF Clone
MG215928 10 µg

Hectd2 (NM_172637) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ETV1 Antibody (C-Term)
orb1926297-01 50 µL

ETV1 Antibody (C-Term)

Sign In for Pricing
View Details