Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial

This Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1 (SLC39A6), partial spans the amino acid sequence from region 1-309aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Expression Region

1-309aa

Tag

C-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MARKLSVILILTFTLSVTNPLHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-POTEA antibody
PAab06646 100 µg

Anti-POTEA antibody

Sign In for Pricing
View Details
Anti-MAP4K5 Antibody Picoband®, PE Conjugate
A10186-2-PE 100 µg/Vial

Anti-MAP4K5 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Mccc1 ORF Vector (Mouse) (pORF)
ORF049930 1.0 µg DNA

Mccc1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Q Sepharose XL in ReadyToProcess columns
Q-271P 1 L

Q Sepharose XL in ReadyToProcess columns

Sign In for Pricing
View Details
CD117 (c-kit, Stem Cell Factor, SCF, Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 750)
MBS6256511-01 0.1 mL

CD117 (c-kit, Stem Cell Factor, SCF, Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 750)

Sign In for Pricing
View Details
CD117 (c-kit, Stem Cell Factor, SCF, Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 750)
MBS6256511-02 5x 0.1 mL

CD117 (c-kit, Stem Cell Factor, SCF, Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 750)

Sign In for Pricing
View Details