Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial, Biotinylated
This Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial, Biotinylated spans the amino acid sequence from region 37-162aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
UniProt
P16410
Expression Region
37-162aa
Tag
C-terminal mFc-Avi-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
42.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal CCR2 Antibody (890231) [mFluor Violet 610 SE]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
FAB8368MFV610 0.1 mL
Mouse Monoclonal CCR2 Antibody (890231) [mFluor Violet 610 SE]
Sign In for Pricing
View Details ![Rabbit Polyclonal MUPP1 Antibody [DyLight 594]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP1-49975DL594 0.1 mL
Rabbit Polyclonal MUPP1 Antibody [DyLight 594]
Sign In for Pricing
View Details MBS7274781-01 48 Well
Canine Receptor Interacting Serine Threonine Kinase 1 ELISA Kit
Sign In for Pricing
View Details MBS7274781-02 96 Well
Canine Receptor Interacting Serine Threonine Kinase 1 ELISA Kit
Sign In for Pricing
View Details MBS7274781-03 5x 96 Well
Canine Receptor Interacting Serine Threonine Kinase 1 ELISA Kit
Sign In for Pricing
View Details