Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early activation antigen CD69 (CD69), partial

This Recombinant Human Early activation antigen CD69 (CD69), partial spans the amino acid sequence from region 64-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)

UniProt

Q07108

Expression Region

64-199aa

Tag

N-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD20A3 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-9747R-BF555 100 µL

ANKRD20A3 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Phospho-MYBL2 (S577) Antibody
MBS7119905-01 0.05 mg

Phospho-MYBL2 (S577) Antibody

Sign In for Pricing
View Details
Phospho-MYBL2 (S577) Antibody
MBS7119905-02 0.1 mg

Phospho-MYBL2 (S577) Antibody

Sign In for Pricing
View Details
Phospho-MYBL2 (S577) Antibody
MBS7119905-03 5x 0.1 mg

Phospho-MYBL2 (S577) Antibody

Sign In for Pricing
View Details
CYMD sgRNA CRISPR Lentivector (Human) (Target 3)
K0548704 1.0 µg DNA

CYMD sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
IKB alpha Antibody (YA6438)
HY-P86746 1 Each

IKB alpha Antibody (YA6438)

Sign In for Pricing
View Details