Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early activation antigen CD69 (CD69), partial

This Recombinant Human Early activation antigen CD69 (CD69), partial spans the amino acid sequence from region 64-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)

UniProt

Q07108

Expression Region

64-199aa

Tag

N-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem212 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3089804 1.0 µg DNA

Tmem212 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Olr693 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV637792 1.0 µg DNA

Olr693 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase TRIM21 (TRIM21)
RPC31164-01 20 µg

Recombinant Human E3 ubiquitin-protein ligase TRIM21 (TRIM21)

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase TRIM21 (TRIM21)
RPC31164-02 100 µg

Recombinant Human E3 ubiquitin-protein ligase TRIM21 (TRIM21)

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase TRIM21 (TRIM21)
RPC31164-03 1 mg

Recombinant Human E3 ubiquitin-protein ligase TRIM21 (TRIM21)

Sign In for Pricing
View Details
UBE2D3 (Ubiquitin-conjugating Enzyme E2D 3 (UBC4/5 Homolog, yeast), E2 (17) KB3, MGC43926, MGC5416, UBC4/5, UBCH5C) (MaxLight 490)
253203-ML490 100 µL

UBE2D3 (Ubiquitin-conjugating Enzyme E2D 3 (UBC4/5 Homolog, yeast), E2 (17) KB3, MGC43926, MGC5416, UBC4/5, UBCH5C) (MaxLight 490)

Sign In for Pricing
View Details