Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Fibroblast growth factor 2 (FGF2)

This Recombinant Chicken Fibroblast growth factor 2 (FGF2) spans the amino acid sequence from region 13-158aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)

UniProt

P48800

Expression Region

13-158aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prss1 Rat Pre-designed siRNA Set A
HY-RS24773 1 Set

Prss1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Monoclonal Integrin beta 3/CD61 Antibody (ITGB3/1713) [Alexa Fluor 750]
NBP2-54562AF750 0.1 mL

Mouse Monoclonal Integrin beta 3/CD61 Antibody (ITGB3/1713) [Alexa Fluor 750]

Sign In for Pricing
View Details
PISD Rabbit pAb
E45R25553N-100 100 µL

PISD Rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal Factor XII heavy chain Antibody (OTI1H5) [Alexa Fluor 750]
NBP2-70695AF750 0.1 mL

Mouse Monoclonal Factor XII heavy chain Antibody (OTI1H5) [Alexa Fluor 750]

Sign In for Pricing
View Details
Zfp787 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV639550 1.0 µg DNA

Zfp787 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
WAVE3 Polyclonal Antibody
MBS2537574-01 0.02 mL

WAVE3 Polyclonal Antibody

Sign In for Pricing
View Details