Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Caenorhabditis elegans Dauer larva development regulatory growth factor daf-7 (daf-7)

This Recombinant Caenorhabditis elegans Dauer larva development regulatory growth factor daf-7 (daf-7) spans the amino acid sequence from region 235-350aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Abnormal dauer formation protein 7)

UniProt

P92172

Expression Region

235-350aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Caenorhabditis elegans

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SHAKPVCNAEAQSKGCCLYDLEIEFEKIGWDWIVAPPRYNAYMCRGDCHYNAHHFNLAETGHSKIMRAAHKVSNPEIGYCCHPTEYDYIKLIYVNRDGRVSIANVNGMIAKKCGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPFIA2 Antibody
E40PV8621 50 µL

PPFIA2 Antibody

Sign In for Pricing
View Details
Lentiviral human P3H3 shRNA (UAS) - Lentiviral human P3H3 shRNA (UAS, GFP) (100)
GTR15163641 1 Vial

Lentiviral human P3H3 shRNA (UAS) - Lentiviral human P3H3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rilpl2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7391808 1.0 µg DNA

Rilpl2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
OptiVitro® CHO Serum_x0002_free Feed Medium TransExp CA07 (Powder)
CA000-N075 1 L

OptiVitro® CHO Serum_x0002_free Feed Medium TransExp CA07 (Powder)

Sign In for Pricing
View Details
TMEM87A Monoclonal Rat Monoclonal Antibody
orb2956173-01 50 µg

TMEM87A Monoclonal Rat Monoclonal Antibody

Sign In for Pricing
View Details
TMEM87A Monoclonal Rat Monoclonal Antibody
orb2956173-02 100 µg

TMEM87A Monoclonal Rat Monoclonal Antibody

Sign In for Pricing
View Details