Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Anoctamin-1 (ANO1), partial

This Recombinant Human Anoctamin-1 (ANO1), partial spans the amino acid sequence from region 806-892aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Discovered on gastrointestinal stromal tumors protein 1) (Oral cancer overexpressed protein 2) (Transmembrane protein 16A) (Tumor-amplified and overexpressed sequence 2)

UniProt

Q5XXA6

Expression Region

806-892aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose b-O-BSA Colloidal Gold Conjugate, 1mL 20nm
CCG-1001-20 1 mL

Glucose b-O-BSA Colloidal Gold Conjugate, 1mL 20nm

Sign In for Pricing
View Details
Benzyl 2,2,2-Trifluoroethyl Sulphide
TRC-B130033-500MG 500 mg

Benzyl 2,2,2-Trifluoroethyl Sulphide

Sign In for Pricing
View Details
EEF2K (NM_013302) Human Recombinant Protein
TP307496L 1 mg

EEF2K (NM_013302) Human Recombinant Protein

Sign In for Pricing
View Details
8-Bromo Adenosine
TRC-B679375-5G 5 g

8-Bromo Adenosine

Sign In for Pricing
View Details
TAGLN Polyclonal Antibody
E-AB-11588-01 20 µL

TAGLN Polyclonal Antibody

Sign In for Pricing
View Details
TAGLN Polyclonal Antibody
E-AB-11588-02 60 µL

TAGLN Polyclonal Antibody

Sign In for Pricing
View Details