Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ER membrane protein complex subunit 10 (EMC10), partial

This Recombinant Human ER membrane protein complex subunit 10 (EMC10), partial spans the amino acid sequence from region 26-221aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Hematopoietic signal peptide-containing membrane domain-containing protein 1)

UniProt

Q5UCC4

Expression Region

26-221aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase Double Nickase Plasmid (m)
sc-423566-NIC 20 µg

Tyrosinase Double Nickase Plasmid (m)

Sign In for Pricing
View Details
ZNF354B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
51472111 3x 1.0 µg

ZNF354B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
(3-Ethoxyphenyl) acetone
FE67129-01 5 g

(3-Ethoxyphenyl) acetone

Sign In for Pricing
View Details
(3-Ethoxyphenyl) acetone
FE67129-02 10 g

(3-Ethoxyphenyl) acetone

Sign In for Pricing
View Details
(3-Ethoxyphenyl) acetone
FE67129-03 25 g

(3-Ethoxyphenyl) acetone

Sign In for Pricing
View Details
Recombinant Human NECTIN2 Protein, C-hFc & AVI-tagged
IMP-1395 20 µg

Recombinant Human NECTIN2 Protein, C-hFc & AVI-tagged

Sign In for Pricing
View Details