Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-9 (IL9)

This Recombinant Human Interleukin-9 (IL9) spans the amino acid sequence from region 19-144aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-9) (Cytokine P40) (T-cell growth factor P40)

UniProt

P15248

Expression Region

19-144aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAT2 Antibody
OAAN02478-100UL 100 µL

ACAT2 Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Marinum rpmJ Protein (aa 1-37)
VAng-Yyj4556-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Marinum rpmJ Protein (aa 1-37)

Sign In for Pricing
View Details
Mrm2 (NM_026510) Mouse Tagged Lenti ORF Clone
MR203082L4 10 µg

Mrm2 (NM_026510) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cpm Rat shRNA Plasmid (Locus ID 314855)
TR706642 1 Kit

Cpm Rat shRNA Plasmid (Locus ID 314855)

Sign In for Pricing
View Details
Mouse Monoclonal ABCC11 Antibody (ABCC11/2438) - Azide and BSA Free
NBP3-24276 100 µg

Mouse Monoclonal ABCC11 Antibody (ABCC11/2438) - Azide and BSA Free

Sign In for Pricing
View Details
Human Protein C-ets-1, ETS1 ELISA KIT
ELI-26928h 96 Tests

Human Protein C-ets-1, ETS1 ELISA KIT

Sign In for Pricing
View Details