Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-9 (IL9)

This Recombinant Human Interleukin-9 (IL9) spans the amino acid sequence from region 19-144aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-9) (Cytokine P40) (T-cell growth factor P40)

UniProt

P15248

Expression Region

19-144aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-3962 inhibitor
HY-RI03126-01 5 nmol

Mmu-miR-3962 inhibitor

Sign In for Pricing
View Details
Mmu-miR-3962 inhibitor
HY-RI03126-02 20 nmol

Mmu-miR-3962 inhibitor

Sign In for Pricing
View Details
TBX5 (T-box Transcription Factor TBX5, T-box Protein 5) (FITC)
134267-FITC 100 µL

TBX5 (T-box Transcription Factor TBX5, T-box Protein 5) (FITC)

Sign In for Pricing
View Details
Anti-RAB13 Antibody (R3M44)
RHE80401 100 μg

Anti-RAB13 Antibody (R3M44)

Sign In for Pricing
View Details
Cat Chemokine C-C-Motif Ligand 4 Like Protein 1 ELISA Kit
MBS050705 Inquire

Cat Chemokine C-C-Motif Ligand 4 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
RUFY2 Rabbit pAb
E45R27869N-100 100 µL

RUFY2 Rabbit pAb

Sign In for Pricing
View Details