Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein RRP5 homolog (PDCD11), partial

This Recombinant Human Protein RRP5 homolog (PDCD11), partial spans the amino acid sequence from region 1200-1420aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(NF-kappa-B-binding protein) (NFBP) (Programmed cell death protein 11)

UniProt

Q14690

Expression Region

1200-1420aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQALRATVVGPDSSKTLLCLSLTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTARVLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NADPH oxidase 1 (NOX1) Elisa Kit
EK715731 96 Well

Human NADPH oxidase 1 (NOX1) Elisa Kit

Sign In for Pricing
View Details
Camk2n2 Rat shRNA Plasmid (Locus ID 59314)
TL710471 1 Kit

Camk2n2 Rat shRNA Plasmid (Locus ID 59314)

Sign In for Pricing
View Details
AMMECR1LP1 Protein Vector (Human) (pPB-N-His)
PV062058 500 ng

AMMECR1LP1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PICK1 (F-10) : m-IgGκ BP-HRP Bundle
sc-534803 1 Kit

PICK1 (F-10) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
POLR3F Antibody
A70150-100UG 100 µg

POLR3F Antibody

Sign In for Pricing
View Details
TRNAE34P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV751758 1.0 µg DNA

TRNAE34P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details