Recombinant Rat Vesicular glutamate transporter 2 (Slc17a6), partial
This Recombinant Rat Vesicular glutamate transporter 2 (Slc17a6), partial spans the amino acid sequence from region 499-582aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(VGluT2) (Differentiation-associated BNPI) (Differentiation-associated Na (+) (Solute carrier family 17 member 6)
UniProt
Q9JI12
Expression Region
499-582aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Rattus norvegicus (Rat)
Field of Research
Neuroscience
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
17.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10438700 96 Well
Bovine Long Palate, Lung And Nasal Epithelium Carcinoma Associated Protein 4 ELISA kit
Sign In for Pricing
View Details 
VAng-Wyb7246-100g 100 µg
Recombinant IAV H7N3 Hemagglutinin / HA Protein (aa 1-524) [His]
Sign In for Pricing
View Details 
NBP2-37714MFV500 0.1 mL
Mouse Monoclonal CD2 Antibody (TS1/8) [mFluor Violet 500 SE]
Sign In for Pricing
View Details