Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Envelope glycoprotein L (gL)

This Recombinant Human cytomegalovirus Envelope glycoprotein L (gL) spans the amino acid sequence from region 31-278aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(gL)

UniProt

F5HCH8

Expression Region

31-278aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Hydroxytridecanoic acid
HY-N7815-01 5 mg

3-Hydroxytridecanoic acid

Sign In for Pricing
View Details
3-Hydroxytridecanoic acid
HY-N7815-02 10 mg

3-Hydroxytridecanoic acid

Sign In for Pricing
View Details
3-Hydroxytridecanoic acid
HY-N7815-03 25 mg

3-Hydroxytridecanoic acid

Sign In for Pricing
View Details
3-Hydroxytridecanoic acid
HY-N7815-04 50 mg

3-Hydroxytridecanoic acid

Sign In for Pricing
View Details
3-Hydroxytridecanoic acid
HY-N7815-05 100 mg

3-Hydroxytridecanoic acid

Sign In for Pricing
View Details
Mucin 6 (MUC6, Mucin 6, Gastric, Oligomeric Mucus/Gel-Forming) (PE)
052388 200 µL

Mucin 6 (MUC6, Mucin 6, Gastric, Oligomeric Mucus/Gel-Forming) (PE)

Sign In for Pricing
View Details