Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Scaffold protein ILK (ILK)

This Recombinant Human Integrin-linked protein kinase (ILK) spans the amino acid sequence from region 1-452aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

59KDA serine/threonine-protein kinaseILK-1ILK-2p59ILK

UniProt

Q13418

Expression Region

1-452aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARGFX Human Gene Knockout Kit (CRISPR)
KN424912 1 Kit

ARGFX Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS707088 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
OR9G9 (NM_001013358) Human Over-expression Lysate
LC422965 20 µg

OR9G9 (NM_001013358) Human Over-expression Lysate

Sign In for Pricing
View Details
EIF1 (4-8) Rabbit Polyclonal Antibody
AP26070PU-N 100 µL

EIF1 (4-8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS701621 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
20b-Dihydrocortisol 21-Acetate
TRC-D448746-250MG 250 mg

20b-Dihydrocortisol 21-Acetate

Sign In for Pricing
View Details