Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesobuthus martensii Beta-insect depressant toxin BmKITa, partial

This Recombinant Mesobuthus martensii Beta-insect depressant toxin BmKITa, partial spans the amino acid sequence from region 22-82aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BmK ITa) (BmK dITAP3)

UniProt

Q9XY87

Expression Region

22-82aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGYIRGSNGCKVSCLWGNEGCNKECRAYGASYGYCWTWGLACWCQGLPDDKTWKSESNTCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trans-2-Octenoic Acid
TRC-T705480-1G 1 g

trans-2-Octenoic Acid

Sign In for Pricing
View Details
DENND2B (NM_005418) Human Over-expression Lysate
LC429252 20 µg

DENND2B (NM_005418) Human Over-expression Lysate

Sign In for Pricing
View Details
RPL8 Rabbit Polyclonal Antibody
TA365365 100 µL

RPL8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human beta Amylase/AMY2 Protein (Fc Tag)
PKSH031979 100 µg

Recombinant Human beta Amylase/AMY2 Protein (Fc Tag)

Sign In for Pricing
View Details
CNKR1 Antibody
8C11460-AAT 50 µg

CNKR1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS706904 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details