Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Myoglobin (MB)

This Recombinant Macaca fascicularis Myoglobin (MB) spans the amino acid sequence from region 2-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P02150

Expression Region

2-154aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGVTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKHPGDFGADAQGAMNKALELFRNDMAAKYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADH6 Antibody
E315028 100 µg - 200 µL

ADH6 Antibody

Sign In for Pricing
View Details
EKLF Lentiviral Activation Particles (h)
sc-402366-LAC 200 µL

EKLF Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
WDR45 Recombinant Protein ()
OPCA04960-20UG 20 µg

WDR45 Recombinant Protein ()

Sign In for Pricing
View Details
Violet Red Bile Glucose Agar
LA2360 250 g

Violet Red Bile Glucose Agar

Sign In for Pricing
View Details
Guinea Pig Transcription factor GATA 6 (GATA6) ELISA kit
GTR10418030 96 Well

Guinea Pig Transcription factor GATA 6 (GATA6) ELISA kit

Sign In for Pricing
View Details
EB3 (7) HRP
sc-136405 HRP 200 µg/mL

EB3 (7) HRP

Sign In for Pricing
View Details