Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Slit homolog 3 protein (SLIT3), partial

This Recombinant Human Slit homolog 3 protein (SLIT3), partial spans the amino acid sequence from region 34-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Slit-3) (Multiple epidermal growth factor-like domains protein 5) (Multiple EGF-like domains protein 5)

UniProt

O75094

Expression Region

34-155aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mbd5 shRNA (UAS) - Lentiviral mouse Mbd5 shRNA (UAS, GFP) (100)
GTR15165561 1 Vial

Lentiviral mouse Mbd5 shRNA (UAS) - Lentiviral mouse Mbd5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
RBM5 discontinued
393764 200 µL

RBM5 discontinued

Sign In for Pricing
View Details
IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody
TA384871 100 µL

IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RFC3, ID (Replication Factor C Subunit 3, Activator 1 Subunit 3, Replication Factor C 38kD Subunit, RF-C 38kD Subunit, RFC38, Activator 1 38kD Subunit, A1 38kD Subunit) (MaxLight 650) discontinued
R1992-78J-ML650 100 µL

RFC3, ID (Replication Factor C Subunit 3, Activator 1 Subunit 3, Replication Factor C 38kD Subunit, RF-C 38kD Subunit, RFC38, Activator 1 38kD Subunit, A1 38kD Subunit) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Tachykinin Double Nickase Plasmid (h)
sc-400690-NIC 20 µg

Tachykinin Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Human CD243/P-Glycoprotein Antibody
E55A06035 100 µg

Human CD243/P-Glycoprotein Antibody

Sign In for Pricing
View Details