Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteasome activator complex subunit 3 (PSME3)

This Recombinant Human Proteasome activator complex subunit 3 (PSME3) spans the amino acid sequence from region 2-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(11S regulator complex subunit gamma) (REG-gamma) (Activator of multicatalytic protease subunit 3) (Ki nuclear autoantigen) (Proteasome activator 28 subunit gamma) (PA28g) (PA28gamma)

UniProt

P61289

Expression Region

2-254aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R) -tert-Butyl 3- ((6- (diethylamino) pyrimidin-4-yl) oxy) pyrrolidine-1-carboxylate
OR1050423-01 100 mg

(R) -tert-Butyl 3- ((6- (diethylamino) pyrimidin-4-yl) oxy) pyrrolidine-1-carboxylate

Sign In for Pricing
View Details
(R) -tert-Butyl 3- ((6- (diethylamino) pyrimidin-4-yl) oxy) pyrrolidine-1-carboxylate
OR1050423-02 250 mg

(R) -tert-Butyl 3- ((6- (diethylamino) pyrimidin-4-yl) oxy) pyrrolidine-1-carboxylate

Sign In for Pricing
View Details
Caspase-3 p12 Antibody [N15D21]
C15351-01 20 µL

Caspase-3 p12 Antibody [N15D21]

Sign In for Pricing
View Details
Caspase-3 p12 Antibody [N15D21]
C15351-02 100 µL

Caspase-3 p12 Antibody [N15D21]

Sign In for Pricing
View Details
Caspase-3 p12 Antibody [N15D21]
C15351-03 2x 100 μL

Caspase-3 p12 Antibody [N15D21]

Sign In for Pricing
View Details
8-Iodo-GTP
orb64225 5 x 30 ul

8-Iodo-GTP

Sign In for Pricing
View Details