Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-18.2 (CLDN18.2), partial

This Recombinant Human Claudin-18 (CLDN18), partial spans the amino acid sequence from region 28-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P56856

Expression Region

28-80aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC2A2 Mouse Monoclonal Antibody [Clone ID: 5D1]
AM08399PU-N 50 µg

SLC2A2 Mouse Monoclonal Antibody [Clone ID: 5D1]

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)
KN218572RB 1 Kit

AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705928 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Recombinant Human AMH protein (His tag)
PDEH100780-01 20 µg

Recombinant Human AMH protein (His tag)

Sign In for Pricing
View Details
Recombinant Human AMH protein (His tag)
PDEH100780-02 100 µg

Recombinant Human AMH protein (His tag)

Sign In for Pricing
View Details
Recombinant Human AMH protein (His tag)
PDEH100780-03 500 µg

Recombinant Human AMH protein (His tag)

Sign In for Pricing
View Details