Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukosialin (SPN), partial

This Recombinant Human Leukosialin (SPN), partial spans the amino acid sequence from region 20-253aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GPL115) (Galactoglycoprotein) (GALGP) (Leukocyte sialoglycoprotein) (Sialophorin) (CD antigen CD43) (CD43-ct) (CD43ct)

UniProt

P16150

Expression Region

20-253aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calumenin (CALU) Human Gene Knockout Kit (CRISPR)
KN200589LP 1 Kit

Calumenin (CALU) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C5R1 (C5AR1) Rabbit Monoclonal Antibody [Clone ID: 32-G1]
TA386393 200 µg

C5R1 (C5AR1) Rabbit Monoclonal Antibody [Clone ID: 32-G1]

Sign In for Pricing
View Details
RFPL2 Antibody
KC-1371-01 50 μL

RFPL2 Antibody

Sign In for Pricing
View Details
RFPL2 Antibody
KC-1371-02 100 µL

RFPL2 Antibody

Sign In for Pricing
View Details
RFPL2 Antibody
KC-1371-03 1 mL

RFPL2 Antibody

Sign In for Pricing
View Details
SIGLEC6 (NM_001177549) Human Over-expression Lysate
LC432909 20 µg

SIGLEC6 (NM_001177549) Human Over-expression Lysate

Sign In for Pricing
View Details