Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 5B (EIF5B), partial

This Recombinant Human Eukaryotic translation initiation factor 5B (EIF5B), partial spans the amino acid sequence from region 629-846aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(eIF-5B) (Translation initiation factor IF-2)

UniProt

O60841

Expression Region

629-846aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRAPIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTML

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pMG36e Plasmid
PVTY01122 2 µg

pMG36e Plasmid

Sign In for Pricing
View Details
EWSR1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV709862 1.0 µg DNA

EWSR1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Inhibin beta A Overexpression Lysate (Native) - (Dry Ice)
NBL1-11994 0.1 mg

Inhibin beta A Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Human Epithelial Stromal Interaction 1, Breast (EPSTI1) ELISA Kit
RDR-EPSTI1-Hu-01 96 Tests

Human Epithelial Stromal Interaction 1, Breast (EPSTI1) ELISA Kit

Sign In for Pricing
View Details
Human Epithelial Stromal Interaction 1, Breast (EPSTI1) ELISA Kit
RDR-EPSTI1-Hu-02 48 Tests

Human Epithelial Stromal Interaction 1, Breast (EPSTI1) ELISA Kit

Sign In for Pricing
View Details
Eef2k (NM_001267710) Mouse Tagged ORF Clone
MR230987 10 µg

Eef2k (NM_001267710) Mouse Tagged ORF Clone

Sign In for Pricing
View Details