Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial

This Recombinant Escherichia phage T7 T7 RNA polymerase (1), partial spans the amino acid sequence from region 710-805aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DNA-directed RNA polymerase)

UniProt

P00573

Expression Region

710-805aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Escherichia phage T7 (Bacteriophage T7)

Field of Research

Infectious Disease & Virology; Molecular Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKDKKTGEILRKRCAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQDGSHLRKTVVWAHEKYGIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,5-Dimethylimidazolidine-2,4-dione
SAA37427-01 100 mg

1,5-Dimethylimidazolidine-2,4-dione

Sign In for Pricing
View Details
1,5-Dimethylimidazolidine-2,4-dione
SAA37427-02 1 g

1,5-Dimethylimidazolidine-2,4-dione

Sign In for Pricing
View Details
DGCR6L (NM_033257) Human Tagged Lenti ORF Clone
RC200317L4 10 µg

DGCR6L (NM_033257) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OTOS Adenovirus (Mouse)
35803054 1.0 mL

OTOS Adenovirus (Mouse)

Sign In for Pricing
View Details
CARD10 Protein Vector (Mouse) (pPB-N-His)
PV161559 500 ng

CARD10 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human Vascular endothelial zinc finger 1 (VEZF1) ELISA Kit
abx552990 96 Tests

Human Vascular endothelial zinc finger 1 (VEZF1) ELISA Kit

Sign In for Pricing
View Details