Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Odorant-binding protein 2a (OBP2A) (C114S, K127N)

This Recombinant Human Odorant-binding protein 2a (OBP2A) (C114S, K127N) spans the amino acid sequence from region 16-170aa (C114S, K127N) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Odorant-binding protein IIa Short name:OBPIIa

UniProt

Q9NY56

Expression Region

16-170aa (C114S, K127N)

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYSKDQRRGGLRYMGNLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc6 Rabbit pAb
E2381483 100 µL

Cdc6 Rabbit pAb

Sign In for Pricing
View Details
CDC37 Antibody, FITC conjugated
CSB-PA613684LC01HU-01 50 µg

CDC37 Antibody, FITC conjugated

Sign In for Pricing
View Details
CDC37 Antibody, FITC conjugated
CSB-PA613684LC01HU-02 100 µg

CDC37 Antibody, FITC conjugated

Sign In for Pricing
View Details
Human TMTC2 shRNA Plasmid
abx965898-01 150 µg

Human TMTC2 shRNA Plasmid

Sign In for Pricing
View Details
Human TMTC2 shRNA Plasmid
abx965898-02 300 µg

Human TMTC2 shRNA Plasmid

Sign In for Pricing
View Details
OR6W1P sgRNA CRISPR Lentivector (Human) (Target 3)
K1530704 1.0 µg DNA

OR6W1P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details