Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-defensin 6 (Defb6)

This Recombinant Mouse Beta-defensin 6 (Defb6) spans the amino acid sequence from region 23-63aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BD-6) (mBD-6) (Defensin, beta 6)

UniProt

Q91VD6

Expression Region

23-63aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHTF8P1 AAV Vector (Human) (CMV)
16157101 1 µg

CHTF8P1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Phospho-ZNF598 (Y306) Antibody
CSB-PA070224-01 50 µg

Phospho-ZNF598 (Y306) Antibody

Sign In for Pricing
View Details
Phospho-ZNF598 (Y306) Antibody
CSB-PA070224-02 100 µg

Phospho-ZNF598 (Y306) Antibody

Sign In for Pricing
View Details
Rose Bengal C.I. 45440
RRBD128-U 10 g

Rose Bengal C.I. 45440

Sign In for Pricing
View Details
CD151 Antibody (FITC)
orb432922 0.1 mg

CD151 Antibody (FITC)

Sign In for Pricing
View Details
PPP2R5E Recombinant Antibody, HRP Conjugated
bsm-62948R-HRP-TR 20 µL

PPP2R5E Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details