Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-defensin 6 (Defb6)

This Recombinant Mouse Beta-defensin 6 (Defb6) spans the amino acid sequence from region 23-63aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BD-6) (mBD-6) (Defensin, beta 6)

UniProt

Q91VD6

Expression Region

23-63aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP1 (NM_001618) Human Recombinant Protein
TP307085M 100 µg

PARP1 (NM_001618) Human Recombinant Protein

Sign In for Pricing
View Details
2,5-Di (pyridin-4-yl) benzene-1,4-diol
OR1050028-01 100 mg

2,5-Di (pyridin-4-yl) benzene-1,4-diol

Sign In for Pricing
View Details
2,5-Di (pyridin-4-yl) benzene-1,4-diol
OR1050028-02 250 mg

2,5-Di (pyridin-4-yl) benzene-1,4-diol

Sign In for Pricing
View Details
Monkey Fcγ (Fc Fragment of IgG) ELISA Kit
EKE61918 96 Tests

Monkey Fcγ (Fc Fragment of IgG) ELISA Kit

Sign In for Pricing
View Details
Gm10713 3'UTR GFP Stable Cell Line
TU157342 1.0 mL

Gm10713 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
2-Keto-L-gulonic Acid
sc-488772C 10 g

2-Keto-L-gulonic Acid

Sign In for Pricing
View Details