Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-defensin 6 (Defb6)

This Recombinant Mouse Beta-defensin 6 (Defb6) spans the amino acid sequence from region 23-63aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BD-6) (mBD-6) (Defensin, beta 6)

UniProt

Q91VD6

Expression Region

23-63aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FN1 CRISPR Knock Out 293T Cell Line (Human)
20709141 1x 10^6 Cells / 1.0 mL

FN1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Mouse Monoclonal Cyclin B1 Antibody (CCNB1/1098)
NBP2-44687-0.02mg 0.02 mg

Mouse Monoclonal Cyclin B1 Antibody (CCNB1/1098)

Sign In for Pricing
View Details
Hexokinase 1 Antibody / HK1
V5727SAF-100UG 100 µg

Hexokinase 1 Antibody / HK1

Sign In for Pricing
View Details
ADAMTS-4 Lentiviral Activation Particles (m2)
sc-433804-LAC-2 200 µL

ADAMTS-4 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Human TPO ELISA Kit (Ready to Use)
orb552569-01 48 Tests

Human TPO ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human TPO ELISA Kit (Ready to Use)
orb552569-02 96 Tests

Human TPO ELISA Kit (Ready to Use)

Sign In for Pricing
View Details