Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon alpha-2 (IFNA2)

This Recombinant Human Interferon alpha-2 (IFNA2) spans the amino acid sequence from region 24-188aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IFN-alpha-2) (Interferon alpha-A) (LeIF A)

UniProt

P01563

Expression Region

24-188aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1311558 Protein Vector (Rat) (pPB-N-His)
PV299959 500 ng

RGD1311558 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CD7 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV646049 1.0 µg DNA

CD7 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Lysozyme Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-60643R-BF750 100 µL

Lysozyme Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse KRT19 Protein, N-His
MY389012-01 50 µg

Recombinant Mouse KRT19 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse KRT19 Protein, N-His
MY389012-02 100 µg

Recombinant Mouse KRT19 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse KRT19 Protein, N-His
MY389012-03 1 mg

Recombinant Mouse KRT19 Protein, N-His

Sign In for Pricing
View Details