Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon alpha-2 (IFNA2)

This Recombinant Human Interferon alpha-2 (IFNA2) spans the amino acid sequence from region 24-188aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IFN-alpha-2) (Interferon alpha-A) (LeIF A)

UniProt

P01563

Expression Region

24-188aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Bcl-2 Antibody (BCL2/782 + BCL2/796) [DyLight 680]
NBP2-47853FR 0.1 mL

Mouse Monoclonal Bcl-2 Antibody (BCL2/782 + BCL2/796) [DyLight 680]

Sign In for Pricing
View Details
Human UBQLN3 qPCR Primer Pair
QH39925S 200 Tests

Human UBQLN3 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Monoclonal Perilipin-2/ADFP Antibody (ADFP/1494) [Alexa Fluor 350]
NBP2-54598AF350 0.1 mL

Mouse Monoclonal Perilipin-2/ADFP Antibody (ADFP/1494) [Alexa Fluor 350]

Sign In for Pricing
View Details
Anti-Zebrafish SUZ12a/b Antibody FITC Conjugated
AZQ6DC03-FITC 100 µg/Vial

Anti-Zebrafish SUZ12a/b Antibody FITC Conjugated

Sign In for Pricing
View Details
2-Propanethiol
OR1078355-01 25 mL

2-Propanethiol

Sign In for Pricing
View Details
2-Propanethiol
OR1078355-02 500 mL

2-Propanethiol

Sign In for Pricing
View Details