Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Retinol-binding protein 4 (Rbp4)

This Recombinant Rat Retinol-binding protein 4 (Rbp4) spans the amino acid sequence from region 19-201aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Plasma retinol-binding protein) (PRBP) (RBP)

UniProt

P04916

Expression Region

19-201aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLTPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF50 (ZSCAN22) (NM_181846) Human Tagged ORF Clone Lentiviral Particle
RC210960L4V 200 µL

ZNF50 (ZSCAN22) (NM_181846) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CHST9 Rabbit pAb, IRDye 800CW conjugated
orb2885266 100 µL

CHST9 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
ZNF263 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-12217R-BF680 100 µL

ZNF263 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CEACAM5/CD66e Antibody (SPM584) [PE/Cy5.5]
NBP2-34851PECY55 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (SPM584) [PE/Cy5.5]

Sign In for Pricing
View Details
RASGRP3 Mouse Monoclonal Antibody [Clone ID: LBI4G9]
AMM15091VCF 100 µg

RASGRP3 Mouse Monoclonal Antibody [Clone ID: LBI4G9]

Sign In for Pricing
View Details
3-Isothiocyanophenylboronic acid
BII109-01 10 mg

3-Isothiocyanophenylboronic acid

Sign In for Pricing
View Details