Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vicia faba Legumin type B (LEB6), partial

This Recombinant Vicia faba Legumin type B (LEB6), partial spans the amino acid sequence from region 1-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Legumin type B acidic chain) (Legumin type B basic chain)

UniProt

P16079

Expression Region

1-148aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Vicia faba (Broad bean) (Faba vulgaris)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TGF-β1 Aptamer
CTApt-014 10 nmol

Anti-TGF-β1 Aptamer

Sign In for Pricing
View Details
Acetyl tetrapeptide-3
TP2364-01 100 mg

Acetyl tetrapeptide-3

Sign In for Pricing
View Details
Acetyl tetrapeptide-3
TP2364-02 500 mg

Acetyl tetrapeptide-3

Sign In for Pricing
View Details
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
MBS4501648-01 48 Tests

Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

Sign In for Pricing
View Details
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
MBS4501648-02 96 Tests

Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

Sign In for Pricing
View Details
Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit
MBS4501648-03 5x 96 Tests

Human Peptidylglycine Alpha Amidating Monooxygenase (PAM) ELISA Kit

Sign In for Pricing
View Details