Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein A-V (APOA5), partial

This Recombinant Human Apolipoprotein A-V (APOA5), partial spans the amino acid sequence from region 260-366AA. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Apo-AV) (ApoA-V) (Apolipoprotein A5) (Regeneration-associated protein 3)

UniProt

Q6Q788

Expression Region

260-366AA

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGHSHLGDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Avidin protein
30-1056 25 mg

Avidin protein

Sign In for Pricing
View Details
1- (1-Benzofuran-2-yl) -2-methylpropan-1-one
RDA42041-01 250 mg

1- (1-Benzofuran-2-yl) -2-methylpropan-1-one

Sign In for Pricing
View Details
1- (1-Benzofuran-2-yl) -2-methylpropan-1-one
RDA42041-02 2.5 g

1- (1-Benzofuran-2-yl) -2-methylpropan-1-one

Sign In for Pricing
View Details
Mouse Substance P (SP) ELISA Kit
KTE70399-01 48 Tests

Mouse Substance P (SP) ELISA Kit

Sign In for Pricing
View Details
Mouse Substance P (SP) ELISA Kit
KTE70399-02 96 Tests

Mouse Substance P (SP) ELISA Kit

Sign In for Pricing
View Details
Mouse Substance P (SP) ELISA Kit
KTE70399-03 5x 96 Tests

Mouse Substance P (SP) ELISA Kit

Sign In for Pricing
View Details