Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse E3 ubiquitin-protein ligase UBR1 (Ubr1), partial

This Recombinant Mouse E3 ubiquitin-protein ligase UBR1 (Ubr1), partial spans the amino acid sequence from region 1101-1204aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(N-recognin-1) (RING-type E3 ubiquitin transferase UBR1) (Ubiquitin-protein ligase E3-alpha-1) (Ubiquitin-protein ligase E3-alpha-I)

UniProt

O70481

Expression Region

1101-1204aa

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Molecular Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CILCQEEQEVKLENNAMVLSACVQKSTALTQHRGKPVDHLGETLDPLFMDPDLAHGTYTGSCGHVMHAVCWQKYFEAVQLSSQQRIHVDLFDLESGEYLCPLCK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal to Human UBP43 / USP18
MBS241147-01 0.05 mg

Rabbit Polyclonal to Human UBP43 / USP18

Sign In for Pricing
View Details
Rabbit Polyclonal to Human UBP43 / USP18
MBS241147-02 5x 0.05 mg

Rabbit Polyclonal to Human UBP43 / USP18

Sign In for Pricing
View Details
Rno-miR-6319 antagomir
HY-RI04530A-01 5 nmol

Rno-miR-6319 antagomir

Sign In for Pricing
View Details
Rno-miR-6319 antagomir
HY-RI04530A-02 20 nmol

Rno-miR-6319 antagomir

Sign In for Pricing
View Details
INSL3 / RLF (Human) - EIA Kit, CE Mark Certified
EK-035-27CE 96 Well

INSL3 / RLF (Human) - EIA Kit, CE Mark Certified

Sign In for Pricing
View Details
SNX6 Lentiviral Activation Particles (m2)
sc-428270-LAC-2 200 µL

SNX6 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details