Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pediococcus acidilactici Bacteriocin pediocin PA-1 (pedA)

This Recombinant Pediococcus acidilactici Bacteriocin pediocin PA-1 (pedA) spans the amino acid sequence from region 19-62aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Pediocin ACH)

UniProt

P29430

Expression Region

19-62aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Pediococcus acidilactici

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ATP2C1 Antibody [Alexa Fluor 405]
NBP1-76566AF405 0.1 mL

Rabbit Polyclonal ATP2C1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
PSMD11 Antibody, FITC conjugated
A17833-100UG 100 µg

PSMD11 Antibody, FITC conjugated

Sign In for Pricing
View Details
FTH1P18 ORF Vector (Human) (pORF)
21009011 1.0 µg DNA

FTH1P18 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SPIN3 Antibody, HRP conjugated
CSB-PA708489LB01HU-01 50 µg

SPIN3 Antibody, HRP conjugated

Sign In for Pricing
View Details
SPIN3 Antibody, HRP conjugated
CSB-PA708489LB01HU-02 100 µg

SPIN3 Antibody, HRP conjugated

Sign In for Pricing
View Details
Armcx4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3108906 1.0 µg DNA

Armcx4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details