Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein GOLM2 (GOLM2), partial

This Recombinant Human Protein GOLM2 (GOLM2), partial spans the amino acid sequence from region 36-436aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cancer susceptibility candidate gene 4 protein) (CASC4) (Golgi membrane protein 2)

UniProt

Q6P4E1

Expression Region

36-436aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDLLLLVDTHKKQIDQKEADYGRLSSRLQAREGLGKRCEDDKVKLQNNISYQMADIHHLKEQLAELRQEFLRQEDQLQDYRKNNTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQVVPKNIPKVAENVADKNEEPSSNHIPHGKEQIKRGGDAGMPGIEENDLAKVDDLPPALRKPPISVSQHESHQAISHLPTGQPLSPNMPPDSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVSDFHKLKQSRFFDENESPVDPQHGSKLADYNGDDGNVGEYEADKQAELAYNEEEDGDGGEEDVQDDEERELQMDPADYGKQHFNDVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf23 sgRNA CRISPR Lentivector set (Human)
K0239501 3x 1.0 µg

C5orf23 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
SARS-CoV-2-IN-94
T89603-01 10 mg

SARS-CoV-2-IN-94

Sign In for Pricing
View Details
SARS-CoV-2-IN-94
T89603-02 50 mg

SARS-CoV-2-IN-94

Sign In for Pricing
View Details
Sheep Serine/Arginine-Rich Splicing Factor 3 (SFRS3) ELISA Kit
MBS9917185-01 48 Well

Sheep Serine/Arginine-Rich Splicing Factor 3 (SFRS3) ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Arginine-Rich Splicing Factor 3 (SFRS3) ELISA Kit
MBS9917185-02 96 Well

Sheep Serine/Arginine-Rich Splicing Factor 3 (SFRS3) ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Arginine-Rich Splicing Factor 3 (SFRS3) ELISA Kit
MBS9917185-03 5x 96 Well

Sheep Serine/Arginine-Rich Splicing Factor 3 (SFRS3) ELISA Kit

Sign In for Pricing
View Details