Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja sputatrix Cytotoxin 1

This Recombinant Naja sputatrix Cytotoxin 1 spans the amino acid sequence from region 22-81aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cardiotoxin-1) (CTX-1) (Ctx1)

UniProt

O93471

Expression Region

22-81aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Naja sputatrix (Malayan spitting cobra) (Naja naja sputatrix)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKCNKLVPLFYKTCPAGKNLCYKIFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cirh1a-set siRNA/shRNA/RNAi Lentivector (Mouse)
16199094 4x 500 ng

Cirh1a-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Calcipressin 3 (RCAN3) Human shRNA Lentiviral Particle (Locus ID 11123)
TL313361V 500 µL Each

Calcipressin 3 (RCAN3) Human shRNA Lentiviral Particle (Locus ID 11123)

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae rpmH Protein (aa 1-44) (strain NCCP11945)
VAng-Wyb2360-50gEcoli 50 µg (E. coli)

Recombinant Neisseria Gonorrhoeae rpmH Protein (aa 1-44) (strain NCCP11945)

Sign In for Pricing
View Details
XC-1500-595-WT-BK AF Systems Consumables
142330 Roll of 1 Label(s)

XC-1500-595-WT-BK AF Systems Consumables

Sign In for Pricing
View Details
FGF1 (NM_033136) Human Tagged ORF Clone
RG219380 10 µg

FGF1 (NM_033136) Human Tagged ORF Clone

Sign In for Pricing
View Details
PRAMEF16 Human Over-expression Lysate
orb1344071 100 µg

PRAMEF16 Human Over-expression Lysate

Sign In for Pricing
View Details