Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja sputatrix Cytotoxin 1

This Recombinant Naja sputatrix Cytotoxin 1 spans the amino acid sequence from region 22-81aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cardiotoxin-1) (CTX-1) (Ctx1)

UniProt

O93471

Expression Region

22-81aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Naja sputatrix (Malayan spitting cobra) (Naja naja sputatrix)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKCNKLVPLFYKTCPAGKNLCYKIFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zbtb43 (NM_027947) Mouse Tagged Lenti ORF Clone
MR225003L4 10 µg

Zbtb43 (NM_027947) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse TUFT1 shRNA Plasmid
abx973262-01 150 µg

Mouse TUFT1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TUFT1 shRNA Plasmid
abx973262-02 300 µg

Mouse TUFT1 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial
RPC21881-01 20 µg

Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial

Sign In for Pricing
View Details
Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial
RPC21881-02 100 µg

Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial

Sign In for Pricing
View Details
Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial
RPC21881-03 1 mg

Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial

Sign In for Pricing
View Details