Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D subtype ayw Protein P (P), partial

This Recombinant Hepatitis B virus genotype D subtype ayw Protein P (P), partial spans the amino acid sequence from region 336-679aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P03156

Expression Region

336-679aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLLLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS504495 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Spink11 Mouse shRNA Lentiviral Particle (Locus ID 433181)
TL517686V 500 µL Each

Spink11 Mouse shRNA Lentiviral Particle (Locus ID 433181)

Sign In for Pricing
View Details
Human Thimet Oligopeptidase 1 (THOP1) ELISA Kit
EKU07611 96 Tests

Human Thimet Oligopeptidase 1 (THOP1) ELISA Kit

Sign In for Pricing
View Details
Pannexin 1 Antibody, mAb, Rabbit
A04720-50 50 µL

Pannexin 1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
NDUFAB1 (Acyl Carrier Protein, Mitochondrial, ACP, CI-SDAP, NADH-ubiquinone Oxidoreductase 9.6kD Subunit, MGC65095) (HRP)
130217-HRP 100 µL

NDUFAB1 (Acyl Carrier Protein, Mitochondrial, ACP, CI-SDAP, NADH-ubiquinone Oxidoreductase 9.6kD Subunit, MGC65095) (HRP)

Sign In for Pricing
View Details
MYBPC1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2548278 100 µL

MYBPC1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details