Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial

This Recombinant Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial spans the amino acid sequence from region 22-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CD antigen CD3e)

UniProt

Q7YRN2

Expression Region

22-116aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEDIERPDEDTQKTFKVSISGDKVELTCPEDPESEKMTWKRNDMQIYESYDNYMLLESFSEVENSGYYTCTVGEKTSHRLYLKARVCENCVEVDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAF1 Antibody, HRP conjugated
A63934-100UG 100 µg

PAF1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Human GYPC knockout cell line
ABC-KH6561 1 Vial

Human GYPC knockout cell line

Sign In for Pricing
View Details
Prohibitin siRNA (h)
sc-37629 10 µM

Prohibitin siRNA (h)

Sign In for Pricing
View Details
NFKP p105/p50 antibody
70R-34305 100 ug

NFKP p105/p50 antibody

Sign In for Pricing
View Details
HAT1 Antibody
E220077-1 50 µg - 50 µL

HAT1 Antibody

Sign In for Pricing
View Details
GENLISA™ Chicken Leptin (LEP) ELISA
KLC0026 96 Well

GENLISA™ Chicken Leptin (LEP) ELISA

Sign In for Pricing
View Details