Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Apolipoprotein A-I (Apoa1)

This Recombinant Mouse Apolipoprotein A-I (Apoa1) spans the amino acid sequence from region 19-264aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Apo-AI) (ApoA-I) (Apolipoprotein A1) (ProapoA-I)

UniProt

Q00623

Expression Region

19-264aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM9B Protein Vector (Mouse) (pPM-C-His)
PV239989 500 ng

TMEM9B Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal STAT1 [p Ser727] Antibody (PSM1) [DyLight 550]
NB500-515R 0.1 mL

Mouse Monoclonal STAT1 [p Ser727] Antibody (PSM1) [DyLight 550]

Sign In for Pricing
View Details
MLH3 Antibody
E19-3622 100 µg -100 µL

MLH3 Antibody

Sign In for Pricing
View Details
ARRB1 Antibody, HRP conjugated
A13178-100UG 100 µg

ARRB1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Tiagabine hydrochloride 50mg
A16135-50 50 mg

Tiagabine hydrochloride 50mg

Sign In for Pricing
View Details
KIF25 siRNA (Human)
CRH2597-01 15 nmol

KIF25 siRNA (Human)

Sign In for Pricing
View Details