Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli LPS-assembly lipoprotein lptE (lptE)

This Recombinant Escherichia coli LPS-assembly lipoprotein lptE (lptE) spans the amino acid sequence from region 19-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Rare lipoprotein B)

UniProt

P0ADC1

Expression Region

19-193aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDTPATPARVSTTLGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crebzf ORF Vector (Mouse) (pORF)
ORF041986 1.0 µg DNA

Crebzf ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PGF2 alpha Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-2341R-BF647-TR 20 µL

PGF2 alpha Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
AKR1B15 3'UTR Luciferase Stable Cell Line
TU000575 1.0 mL

AKR1B15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
THOC2 (NM_001081550) Human Tagged Lenti ORF Clone
RC222235L3 10 µg

THOC2 (NM_001081550) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olfr1278 (NM_146394) Mouse Tagged Lenti ORF Clone
MR214944L4 10 µg

Olfr1278 (NM_146394) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Monoclonal DC-SIGN/CD209 Antibody (902404) [Janelia Fluor 525]
FAB8345JF525 0.1 mL

Rat Monoclonal DC-SIGN/CD209 Antibody (902404) [Janelia Fluor 525]

Sign In for Pricing
View Details