Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Transcriptional regulatory protein CpxR (cpxR)

This Recombinant Transcriptional regulatory protein CpxR (cpxR) spans the amino acid sequence from region 1-232aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P0AE90

Expression Region

1-232aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Shigella flexneri

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQQQNNDNGSPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZIKV NS1 Matched Antibody Pair Set [ABP-S-07225]
ABP-S-07225 5 Plates

ZIKV NS1 Matched Antibody Pair Set [ABP-S-07225]

Sign In for Pricing
View Details
Trim31 (NM_001106376) Rat Untagged Clone
RN201108 10 µg

Trim31 (NM_001106376) Rat Untagged Clone

Sign In for Pricing
View Details
Vmn1r187 3'UTR Luciferase Stable Cell Line
TU121850 1.0 mL

Vmn1r187 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Pancreatic secretory trypsin inhibitor (SPINK1) ELISA Kit
CK-bio-12776-01 48 Tests

Human Pancreatic secretory trypsin inhibitor (SPINK1) ELISA Kit

Sign In for Pricing
View Details
Human Pancreatic secretory trypsin inhibitor (SPINK1) ELISA Kit
CK-bio-12776-02 96 Tests

Human Pancreatic secretory trypsin inhibitor (SPINK1) ELISA Kit

Sign In for Pricing
View Details
Human Pancreatic secretory trypsin inhibitor (SPINK1) ELISA Kit
CK-bio-12776-03 5x 96 Tests

Human Pancreatic secretory trypsin inhibitor (SPINK1) ELISA Kit

Sign In for Pricing
View Details