Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class II histocompatibility antigen, DRB1 beta chain (HLA-DRB1), partial

This Recombinant Human HLA class II histocompatibility antigen, DRB1 beta chain (HLA-DRB1), partial spans the amino acid sequence from region 30-227aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Human leukocyte antigen DRB1) (HLA-DRB1)

UniProt

P01911

Expression Region

30-227aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR48 (NM_020839) Human Recombinant Protein
TP305497M 100 µg

WDR48 (NM_020839) Human Recombinant Protein

Sign In for Pricing
View Details
PRSS42 (NM_182702) Human Recombinant Protein
TP321595L 1 mg

PRSS42 (NM_182702) Human Recombinant Protein

Sign In for Pricing
View Details
PCDHGB1 Human Gene Knockout Kit (CRISPR)
KN417178 1 Kit

PCDHGB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Scn2b Rabbit Polyclonal Antibody
TA363274 100 µL

Scn2b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADD1 Antibody
OC-1853-01 50 μL

ADD1 Antibody

Sign In for Pricing
View Details
ADD1 Antibody
OC-1853-02 100 µL

ADD1 Antibody

Sign In for Pricing
View Details