Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class II histocompatibility antigen, DRB1 beta chain (HLA-DRB1), partial

This Recombinant Human HLA class II histocompatibility antigen, DRB1 beta chain (HLA-DRB1), partial spans the amino acid sequence from region 30-227aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Human leukocyte antigen DRB1) (HLA-DRB1)

UniProt

P01911

Expression Region

30-227aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Fluorescein isothiocyanate isomer I (FITC)
43825432-100mg 100 mg

5-Fluorescein isothiocyanate isomer I (FITC)

Sign In for Pricing
View Details
Calreticulin Recombinant Rabbit mAb, PE conjugated
orb2352632 100 µL

Calreticulin Recombinant Rabbit mAb, PE conjugated

Sign In for Pricing
View Details
Lentiviral human STK4 shRNA (UAS) - Lentiviral human STK4 shRNA (UAS, iRFP) (100)
GTR15315642 1 Vial

Lentiviral human STK4 shRNA (UAS) - Lentiviral human STK4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human OR8B8 siRNA
abx927334-01 15 nmol

Human OR8B8 siRNA

Sign In for Pricing
View Details
Human OR8B8 siRNA
abx927334-02 30 nmol

Human OR8B8 siRNA

Sign In for Pricing
View Details
AFAP (AFAP1) Mouse Monoclonal Antibody [Clone ID: OTI2A11]
TA810439S 30 µL

AFAP (AFAP1) Mouse Monoclonal Antibody [Clone ID: OTI2A11]

Sign In for Pricing
View Details